Rcc2 Antibody - N-terminal region : HRP

Rcc2 Antibody - N-terminal region : HRP
SKU
AVIARP57289_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Rcc2 is required for completion of mitosis and cytokinesis. It may function as a guanine nucleotide exchange factor for the small GTPase RAC1.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: GATNWDLIGRKEVPKQQAAYRNLGQNLWGPHRYGCLSGVRVRTVVSGSCA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein RCC2

Protein Size: 520

Purification: Affinity Purified
More Information
SKU AVIARP57289_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57289_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 108911
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×