Recombinant Conus vexillum Alpha-conotoxin VxXXC

Recombinant Conus vexillum Alpha-conotoxin VxXXC
SKU
CSB-EP314942DWK-100
Packaging Unit
100 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Others

Uniprot: P0C1W7

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Purity: Greater than 85% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 25.3 kDa

Gene Names: N/A

Organism: Conus vexillum (Flag cone)

Source: E.coli

Expression Region: 1-47aa

Protein Length: Full Length

Target Protein Sequence: DLRQCTRNAPGSTWGRCCLNPMCGNFCCPRSGCTCAYNWRRGIYCSC

Endotoxin: Not test.

Relevance: Alpha-conotoxins act on postsynaptic membranes, they bind to the nicotinic acetylcholine receptors (nAChR) and thus inhibit them. This toxin specifically blocks mammalian neuronal nAChR of the alpha-7/CHRNA7, alpha-3-beta-2/CHRNA3-CHRNB2 and alpha-4-beta-2/CHRNA4-CHRNB2 subtypes. VxXXA and VxXXB inhibit alpha-7/CHRNA7 and alpha-3-beta-2/CHRNA3-CHRNB2 nAChR more efficiently than VxXXC. VxXXB is the most effective at inhibiting alpha-4-beta-2/CHRNA4-CHRNB2 nAChR, followed by VxXXC and VxXXA.

Reference: "Identification of a novel class of nicotinic receptor antagonists: dimeric conotoxins VxXIIA, VxXIIB and VxXIIC from Conus vexillum."Loughnan M., Nicke A., Jones A., Schroeder C.I., Nevin S.T., Adams D.J., Alewood P.F., Lewis R.J.J. Biol. Chem. 281:24745-24755(2006)

Function: Alpha-conotoxins act on postsynaptic membranes, they bind to the nicotinic acetylcholine receptors (nAChR) and thus inhibit them. This toxin specifically blocks mammalian neuronal nAChR of the alpha-7/CHRNA7, alpha-3-beta-2/CHRNA3-CHRNB2 and alpha-4-beta-2/CHRNA4-CHRNB2 subtypes. VxXXA and VxXXB inhibit alpha-7/CHRNA7 and alpha-3-beta-2/CHRNA3-CHRNB2 nAChR more efficiently than VxXXC. VxXXB is the most effective at inhibiting alpha-4-beta-2/CHRNA4-CHRNB2 nAChR, followed by VxXXC and VxXXA.
More Information
SKU CSB-EP314942DWK-100
Manufacturer Cusabio
Manufacturer SKU CSB-EP314942DWK-100
Package Unit 100 µg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF) Download