Research Areas: Others
Uniprot: P39675
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 6xHis-tagged
Purity: Greater than 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 27.0 kDa
Gene Names: DERP3
Organism: Dermatophagoides pteronyssinus (European house dust mite)
Source: Yeast
Expression Region: 30-261aa
Protein Length: Full Length of Mature Protein
Target Protein Sequence: IVGGEKALAGECPYQISLQSSSHFCGGTILDEYWILTAAHCVAGQTASKLSIRYNSLKHSLGGEKISVAKIFAHEKYDSYQIDNDIALIKLKSPMKLNQKNAKAVGLPAKGSDVKVGDQVRVSGWGYLEEGSYSLPSELRRVDIAVVSRKECNELYSKANAEVTDNMICGGDVANGGKDSCQGDSGGPVVDVKNNQVVGIVSWGYGCARKGYPGVYTRVGNFIDWIESKRSQ
Endotoxin: Not test.
Reference: "Cloning and sequencing of the Dermatophagoides pteronyssinus group III allergen, Der p III."Smith W.-A., Chua K.-Y., Kuo M.C., Rogers B.L., Thomas W.R.Clin. Exp. Allergy 24:220-228(1994)
English
Deutsch
