Research Areas: Others
Uniprot: P03705
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 6xHis-GST-tagged
Purity: Greater than 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 35.6 kDa
Gene Names: S
Organism: Escherichia phage lambda (Bacteriophage lambda)
Source: E.coli
Expression Region: 1-37aa
Protein Length: Partial
Target Protein Sequence: MKMPEKHDLLAAILAAKEQGIGAILAFAMAYLRGRYN
Endotoxin: Not test.
Relevance: [Isoform Holin]: Accumulates harmlessly in the cytoplasmic membrane until it reaches a critical concentration that triggers the formation of micron-scale pores (holes) causing host cell membrane disruption and endolysin escape into the periplasmic space. Determines the precise timing of host cell lysis. Participates with the endolysin and spanin proteins in the sequential events which lead to the programmed host cell lysis releasing the mature viral particles from the host cell. ; [Isoform Antiholin]: Counteracts the aggregation of the holin molecules and thus of pore formation.
English
Deutsch
