Recombinant Escherichia coli Glc operon transcriptional activator (glcC)

Recombinant Escherichia coli Glc operon transcriptional activator (glcC)
SKU
CSB-EP364823EGX-1
Packaging Unit
1 mg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Microbiology

Uniprot: P0ACL6

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 6xHis-SUMO-tagged

Purity: Greater than 90% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 44.8 kDa

Gene Names: glcC

Organism: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Source: E.coli

Expression Region: 1-254aa

Protein Length: Full Length

Target Protein Sequence: MKDERRPICEVVAESIERLIIDGVLKVGQPLPSERRLCEKLGFSRSALREGLTVLRGRGIIETAQGRDSRVARLNRVQDTSPLIHLFSTQPRTLYDLLDVRALLEGESARLAATLGTQADFVVITRCYEKMLAASENNKEISLIEHAQLDHAFHLAICQASHNQVLVFTLQSLTDLMFNSVFASVNNLYHRPQQKKQIDRQHARIYNAVLQRLPHVAQRAARDHVRTVKKNLHDIELEGHHLIRSAVPLEMNLS

Endotoxin: Not test.

Relevance: Activator for the glycolate oxidation locus.

Reference: "Extensive mosaic structure revealed by the complete genome sequence of uropathogenic Escherichia coli."Welch R.A., Burland V., Plunkett G. III, Redford P., Roesch P., Rasko D., Buckles E.L., Liou S.-R., Boutin A., Hackett J., Stroud D., Mayhew G.F., Rose D.J., Zhou S., Schwartz D.C., Perna N.T., Mobley H.L.T., Donnenberg M.S., Blattner F.R.Proc. Natl. Acad. Sci. U.S.A. 99:17020-17024(2002)

Function: Activator for the glycolate oxidation locus.
More Information
SKU CSB-EP364823EGX-1
Manufacturer Cusabio
Manufacturer SKU CSB-EP364823EGX-1
Package Unit 1 mg
Quantity Unit STK
Reactivity Escherichia Coli
Application SDS-PAGE
Host Escherichia Coli
Product information (PDF) Download
MSDS (PDF) Download