Recombinant Human ABCA1 Protein

Recombinant Human ABCA1 Protein
SKU
ASBPP-041-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O95477

Gene Name: ABCA1

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: His1171

End Site: Ser1280

Coverage: 0.05

Isoelectric Point: 4.5

Core Sequence: HESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEESGVDAETSDGTLPARRNRRAFGDKQS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 47%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: ABC1; CERP

Alternative protein names: Phospholipid-transporting ATPase ABCA1; ATP-binding cassette sub-family A member 1; ATP-binding cassette transporter 1; ABC-1; ATP-binding cassette 1; Cholesterol efflux regulatory protein

Protein name: ATP binding cassette subfamily A member 1

Full length: 2261 amino acids

Entry name: ABCA1_HUMAN

Product panel: Neuroscience Biomarkers,Enzyme
More Information
SKU ASBPP-041-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-041-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 19
Product information (PDF)
×
MSDS (PDF)
×