Recombinant Human ABCA8 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O94911

Gene Name: ABCA8

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 73%

Start Site: Leu681

End Site: Met780

Coverage: 0.06

Isoelectric Point: 4

Core Sequence: LADRKVFLSQGKLKCAGSSLFLKKKWGIGYHLSLQLNEICVEENITSLVKQHIPDAKLSAKSEGKLIYTLPLERTNKFPELYKDLDSYPDLGIENYGVSM

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 73%, Rat - 40%, Pig - 82%, Cynomolgus monkey - 96%

Alternative gene names: KIAA0822

Alternative protein names: ABC-type organic anion transporter ABCA8; ATP-binding cassette sub-family A member 8

Protein name: ATP binding cassette subfamily A member 8

Full length: 1621 amino acids

Entry name: ABCA8_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3691-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3691-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 10351