Note: Dry Ice fees will be extra-charged
Uniprot: O95870
Gene Name: ABHD16A
Expression System: Escherichia coli
Molecular Weight: 32.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 97%
Start Site: Glu141
End Site: Asn410
Coverage: 0.50
Isoelectric Point: 7.5
Core Sequence: ENKRQLANYNFDFRSWPVDFHWEEPSSRKESRGGPSRRGVALLRPEPLHRGTADTLLNRVKKLPCQITSYLVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNGRRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPLEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIIIYAWSIGGFTATWAAMSYPDVSAMILDASFDDLVPLALKVMPDSWRGLVTRTVRQHLNLN
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 98%, Pig - 98%, Cynomolgus monkey - 99%
Alternative gene names: BAT5; G5; NG26
Alternative protein names: Phosphatidylserine lipase ABHD16A; Alpha/beta hydrolase domain-containing protein 16A; Abhydrolase domain-containing protein 16A; HLA-B-associated transcript 5; hBAT5; Monoacylglycerol lipase ABHD16A; Protein G5
Protein name: abhydrolase domain containing 16A, phospholipase
Full length: 558 amino acids
Entry name: ABHGA_HUMAN
Product panel: Enzyme
English
Deutsch
