Recombinant Human ACOT7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O00154

Gene Name: ACOT7

Expression System: Escherichia coli

Molecular Weight: 25 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Asp171

End Site: Pro380

Coverage: 0.55

Isoelectric Point: 7.5

Core Sequence: DKVLEVPPVVYSRQEQEEEGRKRYEAQKLERMETKWRNGDIVQPVLNPEPNTVSYSQSSLIHLVGPSDCTLHGFVHGGVTMKLMDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGRMTFTSNKSMEIEVLVDADPVVDSSQKRYRAASAFFTYVSLSQEGRSLPVPQLVPETEDEKKRFEEGKGRYLQMKAKRQGHAEPQP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 96%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: BACH

Alternative protein names: Cytosolic acyl coenzyme A thioester hydrolase; Acyl-CoA thioesterase 7; Brain acyl-CoA hydrolase; BACH; hBACH; CTE-IIa; CTE-II; Long chain acyl-CoA thioester hydrolase

Protein name: acyl-CoA thioesterase 7

Full length: 380 amino acids

Entry name: BACH_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3842-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3842-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 11332