Recombinant Human ACSL4 Protein

Recombinant Human ACSL4 Protein
SKU
ASBPP-3692-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O60488

Gene Name: ACSL4

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Asp501

End Site: Gly710

Coverage: 0.30

Isoelectric Point: 6.5

Core Sequence: DWQEGGYTINDKPNPRGEIVIGGQNISMGYFKNEEKTAEDYSVDENGQRWFCTGDIGEFHPDGCLQIIDRKKDLVKLQAGEYVSLGKVEAALKNCPLIDNICAFAKSDQSYVISFVVPNQKRLTLLAQQKGVEGTWVDICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHYLKDIERMYGG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 98%, Pig - 98%, Cynomolgus monkey - 100%

Alternative gene names: ACS4; FACL4; LACS4

Alternative protein names: Long-chain-fatty-acid--CoA ligase 4; Arachidonate--CoA ligase; Long-chain acyl-CoA synthetase 4; LACS 4

Protein name: acyl-CoA synthetase long chain family member 4

Full length: 711 amino acids

Entry name: ACSL4_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3692-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3692-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 2182
Product information (PDF)
×
MSDS (PDF)
×