Recombinant Human ACTC1 Protein

Recombinant Human ACTC1 Protein
SKU
ASBPP-4062-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P68032

Gene Name: ACTC1

Expression System: Escherichia coli

Molecular Weight: 31.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Gln61

End Site: Gly310

Coverage: 0.71

Isoelectric Point: 5.5

Core Sequence: QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: ACTC

Alternative protein names: Actin; alpha cardiac muscle 1; Alpha-cardiac actin) [Cleaved into: Actin; alpha cardiac muscle 1; intermediate form]

Protein name: actin alpha cardiac muscle 1

Full length: 377 amino acids

Entry name: ACTC_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4062-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4062-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 70
Product information (PDF)
×
MSDS (PDF)
×