Recombinant Human ACTG1 Protein

Recombinant Human ACTG1 Protein
SKU
ASBPP-347-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P63261

Gene Name: ACTG1

Expression System: Escherichia coli

Molecular Weight: 30 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Gln41

End Site: Arg290

Coverage: 0.68

Isoelectric Point: 6

Core Sequence: QGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: ACTG

Alternative protein names: Actin; cytoplasmic 2; Gamma-actin) [Cleaved into: Actin; cytoplasmic 2; N-terminally processed]

Protein name: actin gamma 1

Full length: 375 amino acids

Entry name: ACTG_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-347-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-347-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 71
Product information (PDF)
×
MSDS (PDF)
×