Recombinant Human ACTR5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H9F9

Gene Name: ACTR5

Expression System: Escherichia coli

Molecular Weight: 26 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Met351

End Site: Lys560

Coverage: 0.35

Isoelectric Point: 4.5

Core Sequence: MDSPEELQSYIQKLSIAVEQAKQKILQAEVNLEVDVVDSKPETPDLEQLEPSLEDVESMNDFDPLFSEETPGVEKPVTTVQPVFNLAAYHQLFVGTERIRAPEIIFQPSLIGEEQAGIAETLQYILDRYPKDIQEMLVQNVFLTGGNTMYPGMKARMEKELLEMRPFRSSFQVQLASNPVLDAWYGARDWALNHLDDNEVWITRKEYEEK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Rat - 38%, Pig - 90%, Cynomolgus monkey - 98%

Alternative gene names: ARP5

Alternative protein names: Actin-related protein 5; hARP5; Sarcoma antigen NY-SAR-16

Protein name: actin related protein 5

Full length: 607 amino acids

Entry name: ARP5_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-8299-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-8299-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 79913