Recombinant Human ADIPOR1 Protein

Recombinant Human ADIPOR1 Protein
SKU
ASBPP-3334-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q96A54

Gene Name: ADIPOR1

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 92%

Start Site: Gln11

End Site: Arg130

Coverage: 0.36

Isoelectric Point: 6

Core Sequence: QGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 92%, Pig - 93%, Cynomolgus monkey - 98%

Alternative gene names: PAQR1; TESBP1A

Alternative protein names: Adiponectin receptor protein 1; Progestin and adipoQ receptor family member 1; Progestin and adipoQ receptor family member I

Protein name: adiponectin receptor 1

Full length: 375 amino acids

Entry name: PAQR1_HUMAN
More Information
SKU ASBPP-3334-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3334-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 51094
Product information (PDF)
×
MSDS (PDF)
×