Recombinant Human AGPAT4 Protein

Recombinant Human AGPAT4 Protein
SKU
ASBPP-3332-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NRZ5

Gene Name: AGPAT4

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Asp151

End Site: Glu280

Coverage: 0.36

Isoelectric Point: 8

Core Sequence: DRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 89%, Pig - 92%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta; 1-acylglycerol-3-phosphate O-acyltransferase 4; 1-AGP acyltransferase 4; 1-AGPAT 4; Lysophosphatidic acid acyltransferase delta; LPAAT-delta

Protein name: 1-acylglycerol-3-phosphate O-acyltransferase 4

Full length: 378 amino acids

Entry name: PLCD_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3332-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3332-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 56895
Product information (PDF)
×
MSDS (PDF)
×