Recombinant Human AK6 Protein

Recombinant Human AK6 Protein
SKU
ASBPP-2960-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y3D8

Gene Name: AK6

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Thr11

End Site: Gly80

Coverage: 0.47

Isoelectric Point: 4.5

Core Sequence: TPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 89%, Pig - 95%, Cynomolgus monkey - 100%

Alternative gene names: CINAP

Alternative protein names: Adenylate kinase isoenzyme 6; AK6; Adrenal gland protein AD-004; Coilin-interacting nuclear ATPase protein; hCINAP; Dual activity adenylate kinase/ATPase; AK/ATPase

Protein name: adenylate kinase 6

Full length: 172 amino acids

Entry name: KAD6_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-2960-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2960-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 102157402
Product information (PDF)
×
MSDS (PDF)
×