Recombinant Human AKAP12 Protein

Recombinant Human AKAP12 Protein
SKU
ASBPP-378-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q02952

Gene Name: AKAP12

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Val421

End Site: Gly530

Coverage: 0.06

Isoelectric Point: 4.5

Core Sequence: VSTVEERTEEQKTEVEETAGSVPAEELVEMDAEPQEAEPAKELVKLKETCVSGEDPTQGADLSPDEKVLSKPPEGVVSEVEMLSSQERMKVQGSPLKKLFTSTGLKKLSG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 65%, Pig - 89%, Cynomolgus monkey - 96%

Alternative gene names: AKAP250

Alternative protein names: A-kinase anchor protein 12; AKAP-12; A-kinase anchor protein 250 kDa; AKAP 250; Gravin; Myasthenia gravis autoantigen

Protein name: A-kinase anchoring protein 12

Full length: 1782 amino acids

Entry name: AKA12_HUMAN
More Information
SKU ASBPP-378-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-378-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 9590
Product information (PDF)
×
MSDS (PDF)
×