Research Areas: Others
Uniprot: Q6UX46
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Form: Liquid or Lyophilized powder
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Purity: Greater than 85% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Molecular Weight: 21.6 kDa
Gene Names: ALKAL2
Organism: Homo sapiens (Human)
Source: E.coli
Expression Region: 25-152aa
Protein Length: Full Length of Mature Protein
Target Protein Sequence: GAEPREPADGQALLRLVVELVQELRKHHSAEHKGLQLLGRDCALGRAEAAGLGPSPEQRVEIVPRDLRMKDKFLKHLTGPLYFSPKCSKHFHRLYHNTRDCTIPAYYKRCARLLTRLAVSPVCMEDKQ
Endotoxin: Not test.
Relevance: Ligand for receptor tyrosine kinases LTK and ALK. Stimulation of ALK signaling may be involved in regulation of cell proliferation and transformation.
Reference: "Deorphanization of the human leukocyte tyrosine kinase (LTK) receptor by a signaling screen of the extracellular proteome."Zhang H., Pao L.I., Zhou A., Brace A.D., Halenbeck R., Hsu A.W., Bray T.L., Hestir K., Bosch E., Lee E., Wang G., Liu H., Wong B.R., Kavanaugh W.M., Williams L.T.Proc. Natl. Acad. Sci. U.S.A. 111:15741-15745(2014)
English
Deutsch
