Recombinant Human ANGPTL3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y5C1

Gene Name: ANGPTL3

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Gln21

End Site: Gln180

Coverage: 0.37

Isoelectric Point: 5

Core Sequence: QDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Rat - 33%, Pig - 89%, Cynomolgus monkey - 98%

Alternative gene names: ANGPT5

Alternative protein names: Angiopoietin-related protein 3; Angiopoietin-5; ANG-5; Angiopoietin-like protein 3) [Cleaved into: ANGPTL3(17-221; ANGPTL3(17-224]

Protein name: angiopoietin like 3

Full length: 460 amino acids

Entry name: ANGL3_HUMAN

• SKU: ASBPP-1037-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-1037-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 27329