Recombinant Human ANKRD23 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q86SG2

Gene Name: ANKRD23

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Arg61

End Site: His140

Coverage: 0.29

Isoelectric Point: 10.5

Core Sequence: RFNSTRFNLDNLADLENLVQRRKKRLRHRVPPRKPEPLVKPQSQAQVEPVGLEMFLKAAAENQEYLIDKYLTDGGDPNAH

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 39%, Pig - 76%, Cynomolgus monkey - 94%

Alternative gene names: DARP

Alternative protein names: Ankyrin repeat domain-containing protein 23; Diabetes-related ankyrin repeat protein; Muscle ankyrin repeat protein 3

Protein name: ankyrin repeat domain 23

Full length: 305 amino acids

Entry name: ANR23_HUMAN

• SKU: ASBPP-4255-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4255-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 200539