Recombinant Human ANXA2P2 Protein

Recombinant Human ANXA2P2 Protein
SKU
ASBPP-3144-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: A6NMY6

Gene Name: ANXA2P2

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Leu91

End Site: Asp200

Coverage: 0.35

Isoelectric Point: 4

Core Sequence: LSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDAQDLYD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 93%, Pig - 99%, Cynomolgus monkey - 99%

Alternative gene names: ANX2L2; ANX2P2; LPC2B

Alternative protein names: Putative annexin A2-like protein; Annexin A2 pseudogene 2; Lipocortin II pseudogene

Protein name: annexin A2 pseudogene 2

Full length: 339 amino acids

Entry name: AXA2L_HUMAN
More Information
SKU ASBPP-3144-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3144-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 304
Product information (PDF)
×
MSDS (PDF)
×