Recombinant Human ANXA9 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O76027

Gene Name: ANXA9

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 78%

Start Site: Glu121

End Site: Glu210

Coverage: 0.28

Isoelectric Point: 4.5

Core Sequence: ELRTALKASDSAVDVAIEILATRTPPQLQECLAVYKHNFQVEAVDDITSETSGILQDLLLALAKGGRDSYSGIIDYNLAEQDVQALQRAE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 78%, Rat - 42%, Pig - 80%, Cynomolgus monkey - 92%

Alternative gene names: ANX31

Alternative protein names: Annexin A9; Annexin XXXI; Annexin-31; Annexin-9; Pemphaxin

Protein name: annexin A9

Full length: 345 amino acids

Entry name: ANXA9_HUMAN

• SKU: ASBPP-036-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-036-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 8416