Recombinant Human ARFGEF2 Protein

Recombinant Human ARFGEF2 Protein
SKU
ASBPP-2995-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y6D5

Gene Name: ARFGEF2

Expression System: Escherichia coli

Molecular Weight: 24.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Lys641

End Site: Lys830

Coverage: 0.11

Isoelectric Point: 5

Core Sequence: KQQKEIIEHGIELFNKKPKRGIQFLQEQGMLGTSVEDIAQFLHQEERLDSTQVGDFLGDSARFNKEVMYAYVDQLDFCEKEFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVLAYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYEEIEGKKIAMK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 98%

Alternative gene names: ARFGEP2; BIG2

Alternative protein names: Brefeldin A-inhibited guanine nucleotide-exchange protein 2; Brefeldin A-inhibited GEP 2; ADP-ribosylation factor guanine nucleotide-exchange factor 2

Protein name: ARF guanine nucleotide exchange factor 2

Full length: 1785 amino acids

Entry name: BIG2_HUMAN
More Information
SKU ASBPP-2995-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-2995-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 10564
Product information (PDF)
×
MSDS (PDF)
×