Recombinant Human ARHGDIA Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P52565

Gene Name: ARHGDIA

Expression System: Escherichia coli

Molecular Weight: 24.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 97%

Start Site: Met1

End Site: Asp204

Coverage: 1.00

Isoelectric Point: 5.5

Core Sequence: MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 97%

Alternative gene names: GDIA1

Alternative protein names: Rho GDP-dissociation inhibitor 1; Rho GDI 1; Rho-GDI alpha

Protein name: Rho GDP dissociation inhibitor alpha

Full length: 204 amino acids

Entry name: GDIR1_HUMAN

• SKU: ASBPP-3953-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3953-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 396