Recombinant Human ARID3C Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A6NKF2

Gene Name: ARID3C

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Pro31

End Site: Leu110

Coverage: 0.20

Isoelectric Point: 4

Core Sequence: PLPDHRTLQAPEGALGNVGAEEEEDAEEDEEKREEAGAEEEAAEESRPGAQGPSSPSSQPPGLHPHEWTYEEQFKQLYEL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Pig - 74%, Cynomolgus monkey - 85%

Alternative gene names: /

Alternative protein names: AT-rich interactive domain-containing protein 3C; ARID domain-containing protein 3C

Protein name: AT-rich interaction domain 3C

Full length: 412 amino acids

Entry name: ARI3C_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3089-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3089-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 138715