Recombinant Human ARL3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P36405

Gene Name: ARL3

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Met1

End Site: Lys182

Coverage: 1.00

Isoelectric Point: 7.5

Core Sequence: MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 97%, Pig - 99%, Cynomolgus monkey - 99%

Alternative gene names: ARFL3

Alternative protein names: ADP-ribosylation factor-like protein 3

Protein name: ARF like GTPase 3

Full length: 182 amino acids

Entry name: ARL3_HUMAN

• SKU: ASBPP-4122-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4122-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 403