Recombinant Human ARRDC1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N5I2

Gene Name: ARRDC1

Expression System: Escherichia coli

Molecular Weight: 23 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Tyr131

End Site: Asp330

Coverage: 0.47

Isoelectric Point: 7

Core Sequence: YILSPLNLNSIPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVGQALQLHADVENQSGKDTSPVVASLLQKVSYKAKRWIHDVRTIAEVEGAGVKAWRRAQWHEQILVPALPQSALPGCSLIHIDYYLQVSLKAPEATVTLPVFIGNIAVNHAPVSPRPGLGLPPGAPPLVVPSAPPQEEAEAEAAAGGPHFLD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Rat - 86%, Pig - 81%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Arrestin domain-containing protein 1; Alpha-arrestin 1

Protein name: arrestin domain containing 1

Full length: 433 amino acids

Entry name: ARRD1_HUMAN

• SKU: ASBPP-3679-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3679-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 92714