Recombinant Human ARSH Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q5FYA8

Gene Name: ARSH

Expression System: Escherichia coli

Molecular Weight: 23 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 52%

Start Site: Ile231

End Site: Leu410

Coverage: 0.34

Isoelectric Point: 7

Core Sequence: IIQQPMKEEKVASLMLKEALAFIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMVGKILDALDQERLANHTLVYFTSDNGGHLEPLDGAVQLGGWNGIYKGGKGMGGWEGGIRVPGIFRWPSVLEAGRVINEPTSLMDIYPTLSYIGGGILSQDRVIDGQNLMPL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 52%, Rat - 52%, Pig - 68%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Arylsulfatase H; ASH

Protein name: arylsulfatase family member H

Full length: 562 amino acids

Entry name: ARSH_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3663-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3663-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 347527