Recombinant Human ASB18 Protein

Recombinant Human ASB18 Protein
SKU
ASBPP-4198-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q6ZVZ8

Gene Name: ASB18

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 80%

Start Site: Pro11

End Site: Gly230

Coverage: 0.48

Isoelectric Point: 6

Core Sequence: PLNSDLVKRLKSALDAKDEERVRDLICTEITPVDAVIELANDDWMKDPSAQLPTGMLLGDLDHLKPLMDQFFQDANVVFEINKDEMEWQVKSPATFGLSGLWTLEYKRELTTPLCIAAAHGHTACVRHLLGRGADPDASPGGRGALHEACLGGHTACVRLLLQHRADPDLLSAEGLAPLHLCRTAASLGCAQALLEHGASVQRVGGTGRDTPLHVAAQRG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 80%, Rat - 38%, Pig - 89%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Ankyrin repeat and SOCS box protein 18; ASB-18

Protein name: ankyrin repeat and SOCS box containing 18

Full length: 466 amino acids

Entry name: ASB18_HUMAN
More Information
SKU ASBPP-4198-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4198-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 401036
Product information (PDF)
×
MSDS (PDF)
×