Recombinant Human ASTN2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O75129

Gene Name: ASTN2

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Ser271

End Site: Leu370

Coverage: 0.08

Isoelectric Point: 4.5

Core Sequence: SRLQTHNSVIGVPIRETPILDDYDCEEDEEPPRRANHVSREDEFGSQVTHTLDSLGHPGEEKVDFEKKAAAEATQETVESLMQKFKESFRANTPIEIGQL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Pig - 90%, Cynomolgus monkey - 38%

Alternative gene names: KIAA0634

Alternative protein names: Astrotactin-2

Protein name: astrotactin 2

Full length: 1339 amino acids

Entry name: ASTN2_HUMAN

• SKU: ASBPP-3677-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3677-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 23245