Recombinant Human ATP10D Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9P241

Gene Name: ATP10D

Expression System: Escherichia coli

Molecular Weight: 30.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 87%

Start Site: Asp701

End Site: Ser950

Coverage: 0.18

Isoelectric Point: 6

Core Sequence: DAGLLNGKAESLPGQPLACNLCYEAESPDEAALVYAARAYQCTLRSRTPEQVMVDFAALGPLTFQLLHILPFDSVRKRMSVVVRHPLSNQVVVYTKGADSVIMELLSVASPDGASLEKQQMIVREKTQKHLDDYAKQGLRTLCIAKKVMSDTEYAEWLRNHFLAETSIDNREELLLESAMRLENKLTLLGATGIEDRLQEGVPESIEALHKAGIKIWMLTGDKQETAVNIAYACKLLEPDDKLFILNTQS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 46%, Pig - 91%, Cynomolgus monkey - 98%

Alternative gene names: ATPVD; KIAA1487

Alternative protein names: Phospholipid-transporting ATPase VD; ATPase class V type 10D; P4-ATPase flippase complex alpha subunit ATP10D

Protein name: ATPase phospholipid transporting 10D (putative)

Full length: 1426 amino acids

Entry name: AT10D_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3680-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3680-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 57205