Recombinant Human ATP11A Protein

Recombinant Human ATP11A Protein
SKU
ASBPP-3681-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P98196

Gene Name: ATP11A

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 90%

Start Site: Gly391

End Site: Lys500

Coverage: 0.09

Isoelectric Point: 4

Core Sequence: GEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPESSGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 90%, Rat - 39%, Pig - 85%, Cynomolgus monkey - 100%

Alternative gene names: ATPIH; ATPIS; KIAA1021

Alternative protein names: Phospholipid-transporting ATPase IH; ATPase IS; ATPase class VI type 11A; P4-ATPase flippase complex alpha subunit ATP11A

Protein name: ATPase phospholipid transporting 11A

Full length: 1134 amino acids

Entry name: AT11A_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3681-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3681-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 23250
Product information (PDF)
×
MSDS (PDF)
×