Recombinant Human ATP12A Protein

Recombinant Human ATP12A Protein
SKU
ASBPP-3682-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P54707

Gene Name: ATP12A

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: His661

End Site: Phe770

Coverage: 0.12

Isoelectric Point: 4.5

Core Sequence: HRLNIAVEQVNKRDAKAAVVTGMELKDMSSEQLDEILANYQEIVFARTSPQQKLIIVEGCQRQDAVVAVTGDGVNDSPALKKADIGIAMGIAGSDAAKNAADMVLLDDNF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 93%, Pig - 91%, Cynomolgus monkey - 96%

Alternative gene names: ATP1AL1

Alternative protein names: Potassium-transporting ATPase alpha chain 2; HK alpha 2; Non-gastric H(+)/K(+) ATPase subunit alpha; Non-gastric Na(+)/K(+) ATPase subunit alpha; Proton pump; Sodium pump

Protein name: ATPase H+/K+ transporting non-gastric alpha2 subunit

Full length: 1039 amino acids

Entry name: AT12A_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3682-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3682-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 479
Product information (PDF)
×
MSDS (PDF)
×