Recombinant Human alpha 1 Sodium Potassium ATPase Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P05023

Gene Name: ATP1A1

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Phe161

End Site: Gly280

Coverage: 0.13

Isoelectric Point: 6

Core Sequence: FKNMVPQQALVIRNGEKMSINAEEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Sodium/potassium-transporting ATPase subunit alpha-1; Na(+)/K(+) ATPase alpha-1 subunit; Sodium pump subunit alpha-1

Protein name: ATPase Na+/K+ transporting subunit alpha 1

Full length: 1023 amino acids

Entry name: AT1A1_HUMAN

Product panel: Neuroscience Biomarkers,Enzyme

• SKU: ASBPP-4358-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4358-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 476