Recombinant Human ATP6V0A4 Protein

Recombinant Human ATP6V0A4 Protein
SKU
ASBPP-4219-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9HBG4

Gene Name: ATP6V0A4

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 83%

Start Site: Glu71

End Site: Glu180

Coverage: 0.13

Isoelectric Point: 4

Core Sequence: EMQNEIVVQLLEKSPLTPLPREMITLETVLEKLEGELQEANQNQQALKQSFLELTELKYLLKKTQDFFETETNLADDFFTEDTSGLLELKAVPAYMTGKLGFIAGVINRE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 83%, Rat - 49%, Pig - 82%, Cynomolgus monkey - 96%

Alternative gene names: ATP6N1B; ATP6N2

Alternative protein names: V-type proton ATPase 116 kDa subunit a 4; V-ATPase 116 kDa isoform a 4; Vacuolar proton translocating ATPase 116 kDa subunit a isoform 4; Vacuolar proton translocating ATPase 116 kDa subunit a kidney isoform

Protein name: ATPase H+ transporting V0 subunit a4

Full length: 840 amino acids

Entry name: VPP4_HUMAN
More Information
SKU ASBPP-4219-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4219-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 50617
Product information (PDF)
×
MSDS (PDF)
×