Recombinant Human ATP6V1G3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q96LB4

Gene Name: ATP6V1G3

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Lys21

End Site: Lys90

Coverage: 0.69

Isoelectric Point: 9.5

Core Sequence: KLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Pig - 73%, Cynomolgus monkey - 96%

Alternative gene names: ATP6G3

Alternative protein names: V-type proton ATPase subunit G 3; V-ATPase subunit G 3; V-ATPase 13 kDa subunit 3; Vacuolar proton pump subunit G 3

Protein name: ATPase H+ transporting V1 subunit G3

Full length: 118 amino acids

Entry name: VATG3_HUMAN

• SKU: ASBPP-4151-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4151-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 127124