Recombinant Human ATP8A2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NTI2

Gene Name: ATP8A2

Expression System: Escherichia coli

Molecular Weight: 13 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Arg601

End Site: Thr690

Coverage: 0.08

Isoelectric Point: 4

Core Sequence: RLSKDSKYMEETLCHLEYFATEGLRTLCVAYADLSENEYEEWLKVYQEASTILKDRAQRLEECYEIIEKNLLLLGATAIEDRLQAGVPET

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 50%, Pig - 93%, Cynomolgus monkey - 100%

Alternative gene names: ATPIB

Alternative protein names: Phospholipid-transporting ATPase IB; ATPase class I type 8A member 2; ML-1; P4-ATPase flippase complex alpha subunit ATP8A2

Protein name: ATPase phospholipid transporting 8A2

Full length: 1188 amino acids

Entry name: AT8A2_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3683-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3683-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 51761