Recombinant Human AZU1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P20160

Gene Name: AZU1

Expression System: Escherichia coli

Molecular Weight: 36.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 47%

Start Site: Ile27

End Site: Pro250

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 47%, Rat - 39%, Pig - 69%

Alternative gene names: /

Alternative protein names: Azurocidin; Cationic antimicrobial protein CAP37; Heparin-binding protein; HBP; hHBP

Protein name: azurocidin 1

Full length: 251 amino acids

Entry name: CAP7_HUMAN

• SKU: ASBPP-3776-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3776-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 566