Recombinant Human BCAP29 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UHQ4

Gene Name: BCAP29

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Leu131

End Site: Arg240

Coverage: 0.48

Isoelectric Point: 9.5

Core Sequence: LSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Pig - 79%, Cynomolgus monkey - 98%

Alternative gene names: BAP29

Alternative protein names: B-cell receptor-associated protein 29; BCR-associated protein 29; Bap29

Protein name: B cell receptor associated protein 29

Full length: 241 amino acids

Entry name: BAP29_HUMAN

• SKU: ASBPP-3188-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3188-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 55973