Recombinant Human BCAP29 Protein

Recombinant Human BCAP29 Protein
SKU
ASBPP-3188-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UHQ4

Gene Name: BCAP29

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Leu131

End Site: Arg240

Coverage: 0.48

Isoelectric Point: 9.5

Core Sequence: LSNKGVLKTQAENTNKAAKKFMEENEKLKRILKSHGKDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSELQDRLERGNKKR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Pig - 79%, Cynomolgus monkey - 98%

Alternative gene names: BAP29

Alternative protein names: B-cell receptor-associated protein 29; BCR-associated protein 29; Bap29

Protein name: B cell receptor associated protein 29

Full length: 241 amino acids

Entry name: BAP29_HUMAN
More Information
SKU ASBPP-3188-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3188-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 55973
Product information (PDF)
×
MSDS (PDF)
×