Recombinant Human BCAP31 Protein

Recombinant Human BCAP31 Protein
SKU
ASBPP-3768-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P51572

Gene Name: BCAP31

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Ala131

End Site: Pro240

Coverage: 0.50

Isoelectric Point: 5

Core Sequence: ASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Pig - 85%

Alternative gene names: BAP31; DXS1357E

Alternative protein names: B-cell receptor-associated protein 31; BCR-associated protein 31; Bap31; 6C6-AG tumor-associated antigen; Protein CDM; p28

Protein name: B cell receptor associated protein 31

Full length: 246 amino acids

Entry name: BAP31_HUMAN
More Information
SKU ASBPP-3768-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3768-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 10134
Product information (PDF)
×
MSDS (PDF)
×