Recombinant Human BCL2L10 Protein

Recombinant Human BCL2L10 Protein
SKU
ASBPP-3155-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9HD36

Gene Name: BCL2L10

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 49%

Start Site: Met11

End Site: Arg180

Coverage: 0.89

Isoelectric Point: 9.5

Core Sequence: MADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 49%, Rat - 47%, Pig - 55%, Cynomolgus monkey - 78%

Alternative gene names: BCL-B; BCLB; BOO; DIVA

Alternative protein names: Bcl-2-like protein 10; Bcl2-L-10; Anti-apoptotic protein Boo; Anti-apoptotic protein NrH; Apoptosis regulator Bcl-B

Protein name: BCL2 like 10

Full length: 204 amino acids

Entry name: B2L10_HUMAN
More Information
SKU ASBPP-3155-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3155-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 10017
Product information (PDF)
×
MSDS (PDF)
×