Recombinant Human BIK Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q13323

Gene Name: BIK

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 41%

Start Site: Ile11

End Site: Gly110

Coverage: 0.72

Isoelectric Point: 3.5

Core Sequence: ILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 41%, Cynomolgus monkey - 90%

Alternative gene names: NBK

Alternative protein names: Bcl-2-interacting killer; Apoptosis inducer NBK; BIP1; BP4

Protein name: BCL2 interacting killer

Full length: 160 amino acids

Entry name: BIK_HUMAN

• SKU: ASBPP-3198-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3198-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 638