Recombinant Human BMP15 Protein

Recombinant Human BMP15 Protein
SKU
ASBPP-3767-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O95972

Gene Name: BMP15

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Gln268

End Site: Arg392

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Rat - 46%, Pig - 80%

Alternative gene names: GDF9B

Alternative protein names: Bone morphogenetic protein 15; BMP-15; Growth/differentiation factor 9B; GDF-9B

Protein name: bone morphogenetic protein 15

Full length: 392 amino acids

Entry name: BMP15_HUMAN

Product panel: Cytokines
More Information
SKU ASBPP-3767-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3767-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 9210
Product information (PDF)
×
MSDS (PDF)
×