Recombinant Human BRIX1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8TDN6

Gene Name: BRIX1

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Ser271

End Site: Gly350

Coverage: 0.23

Isoelectric Point: 11

Core Sequence: SITAAKYREKQQVKDVQKLRKKEPKTLLPHDPTADVFVTPAEEKPIEIQWVKPEPKVDLKARKKRIYKRQRKMKQRMDSG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 86%, Pig - 92%, Cynomolgus monkey - 99%

Alternative gene names: BRIX; BXDC2

Alternative protein names: Ribosome biogenesis protein BRX1 homolog; Brix domain-containing protein 2

Protein name: biogenesis of ribosomes BRX1

Full length: 353 amino acids

Entry name: BRX1_HUMAN

• SKU: ASBPP-3142-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3142-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 55299