Recombinant Human BVES Protein

Recombinant Human BVES Protein
SKU
ASBPP-3374-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8NE79

Gene Name: POPDC1

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Ser241

End Site: Ser350

Coverage: 0.35

Isoelectric Point: 6.5

Core Sequence: SEPFLYEIFRYLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSSDSDDGLHQFLRGTSSMSSLHVSSPHQRASAKMKPIEEGAEDDDDVFEPAS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 81%, Pig - 87%, Cynomolgus monkey - 99%

Alternative gene names: POP1; POPDC1

Alternative protein names: Blood vessel epicardial substance; hBVES; Popeye domain-containing protein 1; Popeye protein 1

Protein name: popeye domain cAMP effector 1

Full length: 360 amino acids

Entry name: POPD1_HUMAN
More Information
SKU ASBPP-3374-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3374-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 11149
Product information (PDF)
×
MSDS (PDF)
×