Recombinant Human C-C motif chemokine 1 (CCL1)

Recombinant Human C-C motif chemokine 1 (CCL1)
SKU
CSB-MP004774HU-20
Packaging Unit
20 µg
Manufacturer
Cusabio

Availability: loading...
Price is loading...
Research Areas: Immunology

Uniprot: P22362

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Form: Liquid or Lyophilized powder

Tag Info: N-terminal 10xHis-HA-tagged

Purity: Greater than 95% as determined by SDS-PAGE.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Molecular Weight: 12.3 kDa

Gene Names: CCL1

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 24-96aa

Protein Length: Full Length of Mature Protein

Target Protein Sequence: KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK

Endotoxin: Not test.

Relevance: Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8.
More Information
SKU CSB-MP004774HU-20
Manufacturer Cusabio
Manufacturer SKU CSB-MP004774HU-20
Package Unit 20 µg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF) Download