Note: Dry Ice fees will be extra-charged
Uniprot: Q9NS00
Gene Name: C1GALT1
Expression System: Escherichia coli
Molecular Weight: 13.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 87%
Start Site: Val41
End Site: Pro130
Coverage: 0.29
Isoelectric Point: 7
Core Sequence: VLHNDPHARHSDDNGQNHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFP
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 87%, Rat - 87%, Pig - 91%, Cynomolgus monkey - 95%
Alternative gene names: /
Alternative protein names: Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1; B3Gal-T8; Core 1 O-glycan T-synthase; Core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1; 3-galactosyltransferase 1; Beta-1; 3-galactosyltransferase; Core 1 beta1; 3-galactosyltransferase 1; C1GalT1; Core 1 beta3-Gal-T1
Protein name: core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
Full length: 363 amino acids
Entry name: C1GLT_HUMAN
Product panel: Enzyme
English
Deutsch
