Recombinant Human CA5A Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P35218

Gene Name: CA5A

Expression System: Escherichia coli

Molecular Weight: 42.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Trp41

End Site: Asn300

Coverage: 0.99

Isoelectric Point: 6.5

Core Sequence: WQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 76%, Pig - 76%, Cynomolgus monkey - 93%

Alternative gene names: CA5

Alternative protein names: Carbonic anhydrase 5A; mitochondrial; Carbonate dehydratase VA; Carbonic anhydrase VA; CA-VA

Protein name: carbonic anhydrase 5A

Full length: 305 amino acids

Entry name: CAH5A_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3205-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3205-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 763