Recombinant Human CA5A Protein

Recombinant Human CA5A Protein
SKU
ASBPP-3204-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P35218

Gene Name: CA5A

Expression System: Escherichia coli

Molecular Weight: 72.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 76%

Start Site: Trp41

End Site: Asn300

Coverage: 0.99

Isoelectric Point: 6

Core Sequence: WQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 76%, Rat - 76%, Pig - 76%, Cynomolgus monkey - 93%

Alternative gene names: CA5

Alternative protein names: Carbonic anhydrase 5A; mitochondrial; Carbonate dehydratase VA; Carbonic anhydrase VA; CA-VA

Protein name: carbonic anhydrase 5A

Full length: 305 amino acids

Entry name: CAH5A_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3204-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3204-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 763
Product information (PDF)
×
MSDS (PDF)
×